Recombinant Human CX3CR1

Cat.No. : CX3CR1-28062TH
Product Overview : Recombinant full length Human CX3CR1 protein with a proprietary tag; predicted mwt: 65.12 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 355 amino acids
Description : Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 65.120kDa
Tissue specificity : Expressed in lymphoid and neural tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Reduced Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ]
Official Symbol CX3CR1
Synonyms CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28;
Gene ID 1524
mRNA Refseq NM_001171171
Protein Refseq NP_001164642
MIM 601470
Uniprot ID P49238
Chromosome Location 3p21.3
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function C-X3-C chemokine receptor activity; G-protein coupled receptor activity; chemokine receptor activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CX3CR1 Products

Required fields are marked with *

My Review for All CX3CR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon