Recombinant Human CX3CR1

• Cat.No.: CX3CR1-28062TH
• Product Overview: Recombinant full length Human CX3CR1 protein with a proprietary tag; predicted mwt: 65.12 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 355 amino acids
• Description: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
• Molecular Weight: 65.120kDa
• Tissue specificity: Expressed in lymphoid and neural tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Reduced Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ]
• Official Symbol: CX3CR1
• Synonyms: CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28
• Gene ID: 1524
• mRNA Refseq: NM_001171171
• Protein Refseq: NP_001164642
• MIM: 601470
• Uniprot ID: P49238
• Chromosome Location: 3p21.3
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem
• Function: C-X3-C chemokine receptor activity; G-protein coupled receptor activity; chemokine receptor activity; protein binding; receptor activity