Recombinant Full Length Human CXCL1 Protein, GST-tagged

Cat.No. : CXCL1-2225HF
Product Overview : Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 107 amino acids
Description : This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
Molecular Mass : 37.51 kDa
AA Sequence : MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ]
Official Symbol CXCL1
Synonyms CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein , FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha) , MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a
Gene ID 2919
mRNA Refseq NM_001511
Protein Refseq NP_001502
MIM 155730
UniProt ID P09341

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL1 Products

Required fields are marked with *

My Review for All CXCL1 Products

Required fields are marked with *

0
cart-icon