Recombinant Mouse Cxcl12 protein, His-tagged
| Cat.No. : | Cxcl12-2510M |
| Product Overview : | Recombinant Mouse Cxcl12 protein(1-89 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-89 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus ] |
| Official Symbol | Cxcl12 |
| Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; C-X-C motif chemokine 12; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; thymic lymphoma cell-stimulating factor; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; Pbsf; Sdf1; Tlsf; Sdf1a; Sdf1b; Tlsfa; Tlsfb; Tpar1; Scyb12; AI174028; |
| Gene ID | 20315 |
| mRNA Refseq | NM_001012477 |
| Protein Refseq | NP_001012495 |
| ◆ Recombinant Proteins | ||
| CXCL12-20H | Active Recombinant Human CXCL12, Fc tagged | +Inquiry |
| CXCL12-23H | Recombinant Human CXCL12 Protein, Biotin-tagged | +Inquiry |
| Cxcl12-55M | Recombinant Active Mouse CXCL12 Protein, His-tagged(C-ter) | +Inquiry |
| CXCL12-5234H | Recombinant Human CXCL12 protein, His-tagged | +Inquiry |
| Cxcl12-207C | Active Recombinant Mouse Cxcl12 Protein (78 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
| CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl12 Products
Required fields are marked with *
My Review for All Cxcl12 Products
Required fields are marked with *
