Recombinant Full Length Human CYTH3 Protein, GST-tagged
Cat.No. : | CYTH3-2501HF |
Product Overview : | Human CYTH3 full-length ORF (AAH08191.1, 1 a.a. - 179 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 179 amino acids |
Description : | This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.43 kDa |
AA Sequence : | MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYTH3 cytohesin 3 [ Homo sapiens ] |
Official Symbol | CYTH3 |
Synonyms | CYTH3; cytohesin 3; pleckstrin homology, Sec7 and coiled coil domains 3 , PSCD3; cytohesin-3; ARNO3; GRP1; ARF nucleotide-binding site opener 3; general receptor of phosphoinositides 1; pleckstrin homology, Sec7 and coiled-coil domains 3; PH, SEC7 and coiled-coil domain-containing protein 3; PSCD3; |
Gene ID | 9265 |
mRNA Refseq | NM_004227 |
Protein Refseq | NP_004218 |
MIM | 605081 |
UniProt ID | O43739 |
◆ Recombinant Proteins | ||
CYTH3-2305H | Recombinant Human CYTH3 Protein, GST-tagged | +Inquiry |
CYTH3-2501HF | Recombinant Full Length Human CYTH3 Protein, GST-tagged | +Inquiry |
CYTH3-3400H | Recombinant Human CYTH3 Protein, MYC/DDK-tagged | +Inquiry |
CYTH3-1159H | Recombinant Human CYTH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cyth3-2430M | Recombinant Mouse Cyth3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYTH3-1425HCL | Recombinant Human CYTH3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTH3 Products
Required fields are marked with *
My Review for All CYTH3 Products
Required fields are marked with *