Recombinant Full Length Human Cytochrome P450 4F12(Cyp4F12) Protein, His-Tagged
Cat.No. : | RFL14747HF |
Product Overview : | Recombinant Full Length Human Cytochrome P450 4F12(CYP4F12) Protein (Q9HCS2) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF WGHLGLITPTEEGLKNSTQMSATYSQGFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPK DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH LASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP4F12 |
Synonyms | CYP4F12; UNQ568/PRO1129; Cytochrome P450 4F12; CYPIVF12 |
UniProt ID | Q9HCS2 |
◆ Recombinant Proteins | ||
CYP4F12-446C | Recombinant Cynomolgus CYP4F12 Protein, His-tagged | +Inquiry |
CYP4F12-2283H | Recombinant Human CYP4F12 Protein, GST-tagged | +Inquiry |
RFL14747HF | Recombinant Full Length Human Cytochrome P450 4F12(Cyp4F12) Protein, His-Tagged | +Inquiry |
CYP4F12-1162R | Recombinant Rhesus monkey CYP4F12 Protein, His-tagged | +Inquiry |
CYP4F12-2443HF | Recombinant Full Length Human CYP4F12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4F12-7102HCL | Recombinant Human CYP4F12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4F12 Products
Required fields are marked with *
My Review for All CYP4F12 Products
Required fields are marked with *
0
Inquiry Basket