Recombinant Full Length Human Cytokine Receptor Common Subunit Gamma(Il2Rg) Protein, His-Tagged
| Cat.No. : | RFL33937HF |
| Product Overview : | Recombinant Full Length Human Cytokine receptor common subunit gamma(IL2RG) Protein (P31785) (23-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (23-369) |
| Form : | Lyophilized powder |
| AA Sequence : | LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | IL2RG |
| Synonyms | IL2RG; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132 |
| UniProt ID | P31785 |
| ◆ Recombinant Proteins | ||
| IL2RG-151H | Recombinant Human IL2RG Protein, His-tagged | +Inquiry |
| IL2RG-49H | Recombinant Human IL2RG, His-tagged | +Inquiry |
| Il2rg-1716M | Recombinant Mouse Interleukin 2 Receptor, Gamma Chain | +Inquiry |
| IL2RG-323H | Recombinant Human IL2RG Protein, Fc-tagged | +Inquiry |
| IL2RG-2070R | Recombinant Rhesus Macaque IL2RG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
| IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
| IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
| IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *
