Recombinant Full Length Human DMAC1 Protein
Cat.No. : | DMAC1-2684HF |
Product Overview : | Human C9orf123 full-length ORF (ADZ15990.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 614 amino acids |
Description : | DMAC1 (distal membrane arm assembly complex 1) is a Protein Coding gene. |
Form : | Liquid |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | DMAC1 distal membrane arm assembly complex 1 [ Homo sapiens (human) ] |
Official Symbol | DMAC1 |
Synonyms | DMAC1; distal membrane arm assembly complex 1; C9ORF123; chromosome 9 open reading frame 123; transmembrane protein C9orf123; MGC4730; |
Gene ID | 90871 |
mRNA Refseq | NM_033428 |
Protein Refseq | NP_219500 |
MIM | 617261 |
UniProt ID | Q96GE9 |
◆ Recombinant Proteins | ||
RFL22290MF | Recombinant Full Length Mouse Transmembrane Protein C9Orf123 Homolog Protein, His-Tagged | +Inquiry |
RFL24051HF | Recombinant Full Length Human Transmembrane Protein C9Orf123(C9Orf123) Protein, His-Tagged | +Inquiry |
DMAC1-2684HF | Recombinant Full Length Human DMAC1 Protein | +Inquiry |
DMAC1-0183H | Recombinant Human DMAC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMAC1 Products
Required fields are marked with *
My Review for All DMAC1 Products
Required fields are marked with *