Recombinant Full Length Human Transmembrane Protein C9Orf123(C9Orf123) Protein, His-Tagged
Cat.No. : | RFL24051HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein C9orf123(C9orf123) Protein (Q96GE9) (1-116aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-116) |
Form : | Lyophilized powder |
AA Sequence : | MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMG AGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DMAC1 |
Synonyms | DMAC1; C9orf123; TMEM261; Distal membrane-arm assembly complex protein 1; Transmembrane protein 261 |
UniProt ID | Q96GE9 |
◆ Recombinant Proteins | ||
RFL22290MF | Recombinant Full Length Mouse Transmembrane Protein C9Orf123 Homolog Protein, His-Tagged | +Inquiry |
DMAC1-2684HF | Recombinant Full Length Human DMAC1 Protein | +Inquiry |
RFL24051HF | Recombinant Full Length Human Transmembrane Protein C9Orf123(C9Orf123) Protein, His-Tagged | +Inquiry |
DMAC1-0183H | Recombinant Human DMAC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMAC1 Products
Required fields are marked with *
My Review for All DMAC1 Products
Required fields are marked with *