Recombinant Human DMAC1 Protein
| Cat.No. : | DMAC1-0183H |
| Product Overview : | Human C9orf123 full-length ORF (ADZ15990.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | DMAC1 (distal membrane arm assembly complex 1) is a Protein Coding gene. |
| Form : | Liquid |
| Molecular Mass : | 12.8 kDa |
| AA Sequence : | MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | DMAC1 distal membrane arm assembly complex 1 [ Homo sapiens (human) ] |
| Official Symbol | DMAC1 |
| Synonyms | DMAC1; distal membrane arm assembly complex 1; C9ORF123; chromosome 9 open reading frame 123; transmembrane protein C9orf123; MGC4730; |
| Gene ID | 90871 |
| mRNA Refseq | NM_033428 |
| Protein Refseq | NP_219500 |
| MIM | 617261 |
| UniProt ID | Q96GE9 |
| ◆ Recombinant Proteins | ||
| RFL22290MF | Recombinant Full Length Mouse Transmembrane Protein C9Orf123 Homolog Protein, His-Tagged | +Inquiry |
| DMAC1-0183H | Recombinant Human DMAC1 Protein | +Inquiry |
| RFL24051HF | Recombinant Full Length Human Transmembrane Protein C9Orf123(C9Orf123) Protein, His-Tagged | +Inquiry |
| DMAC1-2684HF | Recombinant Full Length Human DMAC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMAC1 Products
Required fields are marked with *
My Review for All DMAC1 Products
Required fields are marked with *
