Recombinant Human DMAC1 Protein

Cat.No. : DMAC1-0183H
Product Overview : Human C9orf123 full-length ORF (ADZ15990.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : DMAC1 (distal membrane arm assembly complex 1) is a Protein Coding gene.
Form : Liquid
Molecular Mass : 12.8 kDa
AA Sequence : MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name DMAC1 distal membrane arm assembly complex 1 [ Homo sapiens (human) ]
Official Symbol DMAC1
Synonyms DMAC1; distal membrane arm assembly complex 1; C9ORF123; chromosome 9 open reading frame 123; transmembrane protein C9orf123; MGC4730;
Gene ID 90871
mRNA Refseq NM_033428
Protein Refseq NP_219500
MIM 617261
UniProt ID Q96GE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMAC1 Products

Required fields are marked with *

My Review for All DMAC1 Products

Required fields are marked with *

0
cart-icon