Recombinant Full Length Human DMRT1 Protein
Cat.No. : | DMRT1-128HF |
Product Overview : | Recombinant full length Human DMRT1 with N terminal proprietary tag; Predicted MWt 67.14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 373 amino acids |
Description : | This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. |
Form : | Liquid |
Molecular Mass : | 67.140kDa inclusive of tags |
AA Sequence : | MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVG AASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCR NHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVA LRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMT ECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSA SGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEAR ASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEP SSFTVTPVIEEDE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | DMRT1 doublesex and mab-3 related transcription factor 1 [ Homo sapiens ] |
Official Symbol | DMRT1 |
Synonyms | DMRT1; doublesex and mab-3 related transcription factor 1; doublesex- and mab-3-related transcription factor 1; DM domain expressed in testis 1; DMT1 |
Gene ID | 1761 |
mRNA Refseq | NM_021951 |
Protein Refseq | NP_068770 |
MIM | 602424 |
UniProt ID | Q9Y5R6 |
◆ Recombinant Proteins | ||
DMRT1-2709H | Recombinant Human DMRT1 Protein, GST-tagged | +Inquiry |
DMRT1-6242H | Recombinant Human DMRT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DMRT1-11663Z | Recombinant Zebrafish DMRT1 | +Inquiry |
DMRT1-2414M | Recombinant Mouse DMRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMRT1-128HF | Recombinant Full Length Human DMRT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMRT1-6898HCL | Recombinant Human DMRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMRT1 Products
Required fields are marked with *
My Review for All DMRT1 Products
Required fields are marked with *
0
Inquiry Basket