Recombinant Full Length Human DMRT1 Protein
Cat.No. : | DMRT1-128HF |
Product Overview : | Recombinant full length Human DMRT1 with N terminal proprietary tag; Predicted MWt 67.14 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 67.140kDa inclusive of tags |
Protein Length : | 373 amino acids |
AA Sequence : | MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVG AASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCR NHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVA LRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMT ECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSA SGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEAR ASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEP SSFTVTPVIEEDE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | DMRT1 doublesex and mab-3 related transcription factor 1 [ Homo sapiens ] |
Official Symbol : | DMRT1 |
Synonyms : | DMRT1; doublesex and mab-3 related transcription factor 1; doublesex- and mab-3-related transcription factor 1; DM domain expressed in testis 1; DMT1 |
Gene ID : | 1761 |
mRNA Refseq : | NM_021951 |
Protein Refseq : | NP_068770 |
MIM : | 602424 |
UniProt ID : | Q9Y5R6 |
Products Types
◆ Recombinant Protein | ||
Dmrt1-2587M | Recombinant Mouse Dmrt1 Protein, Myc/DDK-tagged | +Inquiry |
DMRT1-2709H | Recombinant Human DMRT1 Protein, GST-tagged | +Inquiry |
DMRT1-2414M | Recombinant Mouse DMRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMRT1-4649M | Recombinant Mouse DMRT1 Protein | +Inquiry |
DMRT1-27093TH | Recombinant Human DMRT1 | +Inquiry |
◆ Lysates | ||
DMRT1-6898HCL | Recombinant Human DMRT1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket