Recombinant Full Length Human DPEP2 Protein, GST-tagged
Cat.No. : | DPEP2-4009HF |
Product Overview : | Human DPEP2 full-length ORF ( AAH24021.1, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 399 amino acids |
Description : | DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation (Habib et al., 2003 [PubMed 12738806]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MQPSGLEGPGTFGRWPLLSLLLLLLLLQPVTCAYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVSESSPHMAPVLAVVATFPVLILWL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPEP2 dipeptidase 2 [ Homo sapiens ] |
Official Symbol | DPEP2 |
Synonyms | DPEP2; dipeptidase 2; MBD2; |
Gene ID | 64174 |
mRNA Refseq | NM_022355 |
Protein Refseq | NP_071750 |
MIM | 609925 |
UniProt ID | Q9H4A9 |
◆ Recombinant Proteins | ||
DPEP2-8611H | Recombinant Human DPEP2, His tagged | +Inquiry |
DPEP2-12137H | Recombinant Human DPEP2, GST-tagged | +Inquiry |
DPEP2-2496M | Recombinant Mouse DPEP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPEP2-2350H | Recombinant Human DPEP2 protein, His-tagged | +Inquiry |
DPEP2-4780M | Recombinant Mouse DPEP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPEP2-1162HCL | Recombinant Human DPEP2 cell lysate | +Inquiry |
DPEP2-1177HCL | Recombinant Human DPEP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPEP2 Products
Required fields are marked with *
My Review for All DPEP2 Products
Required fields are marked with *
0
Inquiry Basket