Recombinant Full Length Human DUSP14 Protein, GST-tagged
| Cat.No. : | DUSP14-4097HF |
| Product Overview : | Human DUSP14 full-length ORF ( AAH00370, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 198 amino acids |
| Description : | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
| Molecular Mass : | 47.52 kDa |
| AA Sequence : | MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI |
| Applications : | Phosphatase Assay (Cdc25) Phosphatase Assay (PTP) Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DUSP14 dual specificity phosphatase 14 [ Homo sapiens ] |
| Official Symbol | DUSP14 |
| Synonyms | DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L; |
| Gene ID | 11072 |
| mRNA Refseq | NM_007026 |
| Protein Refseq | NP_008957 |
| MIM | 606618 |
| UniProt ID | O95147 |
| ◆ Recombinant Proteins | ||
| DUSP14-1570Z | Recombinant Zebrafish DUSP14 | +Inquiry |
| DUSP14-1174R | Recombinant Rhesus Macaque DUSP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DUSP14-1349R | Recombinant Rhesus monkey DUSP14 Protein, His-tagged | +Inquiry |
| DUSP14-2511H | Recombinant Human DUSP14, His & MBP tagged | +Inquiry |
| DUSP14-28072TH | Recombinant Human DUSP14, T7 -tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP14 Products
Required fields are marked with *
My Review for All DUSP14 Products
Required fields are marked with *
