Recombinant Full Length Human DUSP14 Protein, GST-tagged

Cat.No. : DUSP14-4097HF
Product Overview : Human DUSP14 full-length ORF ( AAH00370, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 198 amino acids
Description : Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
Molecular Mass : 47.52 kDa
AA Sequence : MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Applications : Phosphatase Assay (Cdc25)
Phosphatase Assay (PTP)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP14 dual specificity phosphatase 14 [ Homo sapiens ]
Official Symbol DUSP14
Synonyms DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L;
Gene ID 11072
mRNA Refseq NM_007026
Protein Refseq NP_008957
MIM 606618
UniProt ID O95147

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP14 Products

Required fields are marked with *

My Review for All DUSP14 Products

Required fields are marked with *

0
cart-icon