Recombinant Human DUSP14 protein, His-SUMO-tagged
Cat.No. : | DUSP14-2830H |
Product Overview : | Recombinant Human DUSP14 protein(O95147 )(1-198aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DUSP14 dual specificity phosphatase 14 [ Homo sapiens ] |
Official Symbol | DUSP14 |
Synonyms | DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L; |
Gene ID | 11072 |
mRNA Refseq | NM_007026 |
Protein Refseq | NP_008957 |
MIM | 606618 |
UniProt ID | O95147 |
◆ Recombinant Proteins | ||
DUSP14-4928H | Recombinant Human DUSP14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP14-1570Z | Recombinant Zebrafish DUSP14 | +Inquiry |
DUSP14-28072TH | Recombinant Human DUSP14, T7 -tagged | +Inquiry |
DUSP14-4097HF | Recombinant Full Length Human DUSP14 Protein, GST-tagged | +Inquiry |
Dusp14-2683M | Recombinant Mouse Dusp14 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP14 Products
Required fields are marked with *
My Review for All DUSP14 Products
Required fields are marked with *
0
Inquiry Basket