Recombinant Full Length Human DUSP5 Protein, GST-tagged
Cat.No. : | DUSP5-4110HF |
Product Overview : | Human DUSP5 full-length ORF (AAH62545.1, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 384 amino acids |
Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 68.64 kDa |
AA Sequence : | MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACMTHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP5 dual specificity phosphatase 5 [ Homo sapiens ] |
Official Symbol | DUSP5 |
Synonyms | DUSP5; dual specificity phosphatase 5; dual specificity protein phosphatase 5; HVH3; VH1-like phosphatase 3; dual specificity protein phosphatase hVH3; serine/threonine specific protein phosphatase; DUSP; |
Gene ID | 1847 |
mRNA Refseq | NM_004419 |
Protein Refseq | NP_004410 |
MIM | 603069 |
UniProt ID | Q16690 |
◆ Recombinant Proteins | ||
DUSP5-2943H | Recombinant Human DUSP5 Protein, GST-tagged | +Inquiry |
DUSP5-7853H | Recombinant Human DUSP5 protein, His-tagged | +Inquiry |
DUSP5-330H | Recombinant Human DUSP5 Protein, His-tagged | +Inquiry |
DUSP5-11845Z | Recombinant Zebrafish DUSP5 | +Inquiry |
DUSP5-382H | Recombinant Human DUSP5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP5 Products
Required fields are marked with *
My Review for All DUSP5 Products
Required fields are marked with *
0
Inquiry Basket