Recombinant Human DUSP5

Cat.No. : DUSP5-28378TH
Product Overview : Recombinant fragment of Human DUSP5 with N terminal proprietary tag; predicted MWt: 36.52 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily.These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation.Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Gene Name DUSP5 dual specificity phosphatase 5 [ Homo sapiens ]
Official Symbol DUSP5
Synonyms DUSP5; dual specificity phosphatase 5; dual specificity protein phosphatase 5; HVH3;
Gene ID 1847
mRNA Refseq NM_004419
Protein Refseq NP_004410
MIM 603069
Uniprot ID Q16690
Chromosome Location 10q25
Pathway ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem;
Function MAP kinase tyrosine/serine/threonine phosphatase activity; hydrolase activity; protein tyrosine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP5 Products

Required fields are marked with *

My Review for All DUSP5 Products

Required fields are marked with *

0
cart-icon