Recombinant Human DUSP5
| Cat.No. : | DUSP5-28378TH |
| Product Overview : | Recombinant fragment of Human DUSP5 with N terminal proprietary tag; predicted MWt: 36.52 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily.These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation.Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
| Gene Name | DUSP5 dual specificity phosphatase 5 [ Homo sapiens ] |
| Official Symbol | DUSP5 |
| Synonyms | DUSP5; dual specificity phosphatase 5; dual specificity protein phosphatase 5; HVH3; |
| Gene ID | 1847 |
| mRNA Refseq | NM_004419 |
| Protein Refseq | NP_004410 |
| MIM | 603069 |
| Uniprot ID | Q16690 |
| Chromosome Location | 10q25 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; |
| Function | MAP kinase tyrosine/serine/threonine phosphatase activity; hydrolase activity; protein tyrosine phosphatase activity; |
| ◆ Recombinant Proteins | ||
| DUSP5-28378TH | Recombinant Human DUSP5 | +Inquiry |
| DUSP5-330H | Recombinant Human DUSP5 Protein, His-tagged | +Inquiry |
| DUSP5-4110HF | Recombinant Full Length Human DUSP5 Protein, GST-tagged | +Inquiry |
| DUSP5-11845Z | Recombinant Zebrafish DUSP5 | +Inquiry |
| Dusp5-383M | Recombinant Mouse Dusp5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP5 Products
Required fields are marked with *
My Review for All DUSP5 Products
Required fields are marked with *
