Recombinant Full Length Human DYDC2 Protein, GST-tagged

Cat.No. : DYDC2-6148HF
Product Overview : Human MGC16186 full-length ORF ( AAH07374, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 177 amino acids
Description : This gene encodes a member of a family of proteins that contains a DPY30 domain. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
Molecular Mass : 45.21 kDa
AA Sequence : METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYDC2 DPY30 domain containing 2 [ Homo sapiens ]
Official Symbol DYDC2
Synonyms DYDC2; DPY30 domain containing 2; DPY30 domain-containing protein 2; bA36D19.6; MGC16186;
Gene ID 84332
mRNA Refseq NM_032372
Protein Refseq NP_115748
UniProt ID Q96IM9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYDC2 Products

Required fields are marked with *

My Review for All DYDC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon