Recombinant Human DYDC2 Protein (1-177 aa), His-SUMO-tagged
Cat.No. : | DYDC2-1076H |
Product Overview : | Recombinant Human DYDC2 Protein (1-177 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-177 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 36.6 kDa |
AA Sequence : | METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | DYDC2 DPY30 domain containing 2 [ Homo sapiens ] |
Official Symbol | DYDC2 |
Synonyms | DYDC2; bA36D19.6; MGC16186; |
Gene ID | 84332 |
mRNA Refseq | NM_032372 |
Protein Refseq | NP_115748 |
UniProt ID | Q96IM9 |
◆ Recombinant Proteins | ||
DYDC2-6148HF | Recombinant Full Length Human DYDC2 Protein, GST-tagged | +Inquiry |
DYDC2-1076H | Recombinant Human DYDC2 Protein (1-177 aa), His-SUMO-tagged | +Inquiry |
DYDC2-7377H | Recombinant Human DYDC2 protein(Thr102-Pro176), GST-tagged | +Inquiry |
DYDC2-4348H | Recombinant Human DYDC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYDC2-518HCL | Recombinant Human DYDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYDC2 Products
Required fields are marked with *
My Review for All DYDC2 Products
Required fields are marked with *