Recombinant Human DYDC2 Protein, GST-tagged
Cat.No. : | DYDC2-4348H |
Product Overview : | Human MGC16186 full-length ORF ( AAH07374, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of proteins that contains a DPY30 domain. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Molecular Mass : | 45.21 kDa |
AA Sequence : | METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYDC2 DPY30 domain containing 2 [ Homo sapiens ] |
Official Symbol | DYDC2 |
Synonyms | DYDC2; DPY30 domain containing 2; DPY30 domain-containing protein 2; bA36D19.6; MGC16186; |
Gene ID | 84332 |
mRNA Refseq | NM_032372 |
Protein Refseq | NP_115748 |
UniProt ID | Q96IM9 |
◆ Recombinant Proteins | ||
DYDC2-4348H | Recombinant Human DYDC2 Protein, GST-tagged | +Inquiry |
DYDC2-7377H | Recombinant Human DYDC2 protein(Thr102-Pro176), GST-tagged | +Inquiry |
DYDC2-1076H | Recombinant Human DYDC2 Protein (1-177 aa), His-SUMO-tagged | +Inquiry |
DYDC2-6148HF | Recombinant Full Length Human DYDC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYDC2-518HCL | Recombinant Human DYDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYDC2 Products
Required fields are marked with *
My Review for All DYDC2 Products
Required fields are marked with *
0
Inquiry Basket