Recombinant Full Length Human EDNRA Protein
Cat.No. : | EDNRA-6775HF |
Product Overview : | Human EDNRA full-length ORF (ENSP00000315011) recombinant protein without tag was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | was amino acids |
Description : | This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Form : | Liquid |
Molecular Mass : | 48.7 kDa |
AA Sequence : | METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | EDNRA endothelin receptor type A [ Homo sapiens (human) ] |
Official Symbol | EDNRA |
Synonyms | EDNRA; endothelin receptor type A; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor |
Gene ID | 1909 |
mRNA Refseq | NM_001957 |
Protein Refseq | NP_001948 |
MIM | 131243 |
UniProt ID | P25101 |
◆ Recombinant Proteins | ||
EDNRA-4994M | Recombinant Mouse EDNRA Protein | +Inquiry |
RFL7142OF | Recombinant Full Length Sheep Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
EDNRA-28562TH | Recombinant Human EDNRA | +Inquiry |
RFL24996RF | Recombinant Full Length Rat Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
EDNRA-764H | Active Recombinant Human EDNRA Full Length Transmembrane protein(VLPs) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *