Recombinant Human EEF1E1, His-tagged

Cat.No. : EEF1E1-27130TH
Product Overview : Recombinant full length protein, (amino acids 1-174) of Human AIMP3/p18 with N terminal His tag; 194 amino acids, 21.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 174 amino acids
Description : This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
Conjugation : HIS
Molecular Weight : 21.900kDa inclusive of tags
Tissue specificity : Down-regulated in various cancer tissues.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGN KYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL LGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS YLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Sequence Similarities : Contains 1 GST C-terminal domain.
Gene Name EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ]
Official Symbol EEF1E1
Synonyms EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3;
Gene ID 9521
mRNA Refseq NM_001135650
Protein Refseq NP_001129122
MIM 609206
Uniprot ID O43324
Chromosome Location 6p24.3
Pathway Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEF1E1 Products

Required fields are marked with *

My Review for All EEF1E1 Products

Required fields are marked with *

0
cart-icon
0
compare icon