Recombinant Full Length Human EFEMP2 Protein, GST-tagged

Cat.No. : EFEMP2-4184HF
Product Overview : Human EFEMP2 full-length ORF (no protein_acc, 1 a.a. - 229 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 229 amino acids
Description : A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 52 kDa
AA Sequence : MGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGPRPAGDGPPGVRAGPGDGHHEFPHELPGQLCTEAHRLCRGLHLLRSRREPPSLHLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ]
Official Symbol EFEMP2
Synonyms EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B;
Gene ID 30008
mRNA Refseq NM_016938
Protein Refseq NP_058634
MIM 604633
UniProt ID O95967

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFEMP2 Products

Required fields are marked with *

My Review for All EFEMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon