Recombinant Human EFEMP2 Protein, GST-tagged
Cat.No. : | EFEMP2-3086H |
Product Overview : | Human EFEMP2 full-length ORF (no protein_acc, 1 a.a. - 229 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 52 kDa |
AA Sequence : | MGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGPRPAGDGPPGVRAGPGDGHHEFPHELPGQLCTEAHRLCRGLHLLRSRREPPSLHLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ] |
Official Symbol | EFEMP2 |
Synonyms | EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B; |
Gene ID | 30008 |
mRNA Refseq | NM_016938 |
Protein Refseq | NP_058634 |
MIM | 604633 |
UniProt ID | O95967 |
◆ Recombinant Proteins | ||
Efemp2-233M | Recombinant Mouse Efemp2 Protein, His-tagged | +Inquiry |
EFEMP2-2107H | Recombinant Human EFEMP2 Protein (Ser26-Phe443), N-GST tagged | +Inquiry |
EFEMP2-52H | Recombinant Human EFEMP2 protein, T7/His-tagged | +Inquiry |
EFEMP2-3086H | Recombinant Human EFEMP2 Protein, GST-tagged | +Inquiry |
EFEMP2-4184HF | Recombinant Full Length Human EFEMP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFEMP2-6704HCL | Recombinant Human EFEMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFEMP2 Products
Required fields are marked with *
My Review for All EFEMP2 Products
Required fields are marked with *