Recombinant Human EFEMP2 protein, T7/His-tagged
Cat.No. : | EFEMP2-52H |
Product Overview : | Recombinant human EFEMP1 cDNA (26 – 443 aa, derived from BC010456) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 26-443 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFELSPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEM KCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLP GSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFN SYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQC SEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVY PGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro EFEMP2 protein mediated cancer cell growth regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for EFEMP2 protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential biomarker protein for diagnosis of malignant pleural mesothelioma..5. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ] |
Official Symbol | EFEMP2 |
Synonyms | EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding prote |
Gene ID | 30008 |
mRNA Refseq | NM_016938 |
Protein Refseq | NP_058634 |
MIM | 604633 |
UniProt ID | O95967 |
Chromosome Location | 11q13 |
Function | calcium ion binding; extracellular matrix structural constituent; protein binding; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
EFEMP2-4184HF | Recombinant Full Length Human EFEMP2 Protein, GST-tagged | +Inquiry |
EFEMP2-3086H | Recombinant Human EFEMP2 Protein, GST-tagged | +Inquiry |
EFEMP2-52H | Recombinant Human EFEMP2 protein, T7/His-tagged | +Inquiry |
Efemp2-233M | Recombinant Mouse Efemp2 Protein, His-tagged | +Inquiry |
EFEMP2-2494H | Recombinant Human EFEMP2 protein(31-120 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFEMP2-6704HCL | Recombinant Human EFEMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFEMP2 Products
Required fields are marked with *
My Review for All EFEMP2 Products
Required fields are marked with *