Recombinant Human EFEMP2 protein, T7/His-tagged

Cat.No. : EFEMP2-52H
Product Overview : Recombinant human EFEMP1 cDNA (26 – 443 aa, derived from BC010456) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 26-443 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFELSPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEM KCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLP GSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFN SYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQC SEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVY PGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro EFEMP2 protein mediated cancer cell growth regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for EFEMP2 protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential biomarker protein for diagnosis of malignant pleural mesothelioma..5. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ]
Official Symbol EFEMP2
Synonyms EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding prote
Gene ID 30008
mRNA Refseq NM_016938
Protein Refseq NP_058634
MIM 604633
UniProt ID O95967
Chromosome Location 11q13
Function calcium ion binding; extracellular matrix structural constituent; protein binding; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFEMP2 Products

Required fields are marked with *

My Review for All EFEMP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon