Recombinant Full Length Human EIF2B1 Protein, GST-tagged
Cat.No. : | EIF2B1-4489HF |
Product Overview : | Human EIF2B1 full-length ORF ( NP_001405.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 305 amino acids |
Description : | This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 60.1 kDa |
AA Sequence : | MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ] |
Official Symbol | EIF2B1 |
Synonyms | EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869; |
Gene ID | 1967 |
mRNA Refseq | NM_001414 |
Protein Refseq | NP_001405 |
MIM | 606686 |
UniProt ID | Q14232 |
◆ Recombinant Proteins | ||
EIF2B1-4489HF | Recombinant Full Length Human EIF2B1 Protein, GST-tagged | +Inquiry |
EIF2B1-1703R | Recombinant Rat EIF2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2B1-4443H | Recombinant Human EIF2B1 protein, GST-tagged | +Inquiry |
EIF2B1-485C | Recombinant Cynomolgus EIF2B1 Protein, His-tagged | +Inquiry |
EIF2B1-230C | Recombinant Cynomolgus Monkey EIF2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2B1-539HCL | Recombinant Human EIF2B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2B1 Products
Required fields are marked with *
My Review for All EIF2B1 Products
Required fields are marked with *
0
Inquiry Basket