Recombinant Full Length Human EIF2B1 Protein, GST-tagged

Cat.No. : EIF2B1-4489HF
Product Overview : Human EIF2B1 full-length ORF ( NP_001405.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 305 amino acids
Description : This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Oct 2009]
Molecular Mass : 60.1 kDa
AA Sequence : MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ]
Official Symbol EIF2B1
Synonyms EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869;
Gene ID 1967
mRNA Refseq NM_001414
Protein Refseq NP_001405
MIM 606686
UniProt ID Q14232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2B1 Products

Required fields are marked with *

My Review for All EIF2B1 Products

Required fields are marked with *

0
cart-icon
0
compare icon