Recombinant Human EIF2B1 protein, GST-tagged
Cat.No. : | EIF2B1-4443H |
Product Overview : | Recombinant Human EIF2B1 protein(Q14232)(1-305aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-305aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ] |
Official Symbol | EIF2B1 |
Synonyms | EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869; |
Gene ID | 1967 |
mRNA Refseq | NM_001414 |
Protein Refseq | NP_001405 |
MIM | 606686 |
UniProt ID | Q14232 |
◆ Recombinant Proteins | ||
EIF2B1-485C | Recombinant Cynomolgus EIF2B1 Protein, His-tagged | +Inquiry |
EIF2B1-294Z | Recombinant Zebrafish EIF2B1 | +Inquiry |
EIF2B1-1703R | Recombinant Rat EIF2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2B1-4443H | Recombinant Human EIF2B1 protein, GST-tagged | +Inquiry |
EIF2B1-3511H | Recombinant Human EIF2B1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2B1-539HCL | Recombinant Human EIF2B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2B1 Products
Required fields are marked with *
My Review for All EIF2B1 Products
Required fields are marked with *