Recombinant Human EIF2B1 protein, GST-tagged

• Cat.No.: EIF2B1-4443H
• Product Overview: Recombinant Human EIF2B1 protein(Q14232)(1-305aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-305aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60.7 kDa
• AA Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ]
• Official Symbol: EIF2B1
• Synonyms: EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869
• Gene ID: 1967
• mRNA Refseq: NM_001414
• Protein Refseq: NP_001405
• MIM: 606686
• UniProt ID: Q14232