Recombinant Human EIF2B1 protein, GST-tagged
| Cat.No. : | EIF2B1-4443H |
| Product Overview : | Recombinant Human EIF2B1 protein(Q14232)(1-305aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-305aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 60.7 kDa |
| AA Sequence : | MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ] |
| Official Symbol | EIF2B1 |
| Synonyms | EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869; |
| Gene ID | 1967 |
| mRNA Refseq | NM_001414 |
| Protein Refseq | NP_001405 |
| MIM | 606686 |
| UniProt ID | Q14232 |
| ◆ Recombinant Proteins | ||
| EIF2B1-1703R | Recombinant Rat EIF2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF2B1-4443H | Recombinant Human EIF2B1 protein, GST-tagged | +Inquiry |
| EIF2B1-485C | Recombinant Cynomolgus EIF2B1 Protein, His-tagged | +Inquiry |
| EIF2B1-4489HF | Recombinant Full Length Human EIF2B1 Protein, GST-tagged | +Inquiry |
| EIF2B1-2046R | Recombinant Rat EIF2B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2B1-539HCL | Recombinant Human EIF2B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2B1 Products
Required fields are marked with *
My Review for All EIF2B1 Products
Required fields are marked with *


