Recombinant Full Length Human EIF4E Protein, GST-tagged

Cat.No. : EIF4E-4287HF
Product Overview : Human EIF4E full-length ORF ( AAH12611, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 217 amino acids
Description : The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 49.61 kDa
AA Sequence : MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4E eukaryotic translation initiation factor 4E [ Homo sapiens ]
Official Symbol EIF4E
Synonyms EIF4E; eukaryotic translation initiation factor 4E; EIF4EL1, EIF4F; EIF4E1; eIF-4E; eIF-4F 25 kDa subunit; mRNA cap-binding protein; eukaryotic translation initiation factor 4E-like 1; CBP; EIF4F; EIF4EL1; MGC111573;
Gene ID 1977
mRNA Refseq NM_001130678
Protein Refseq NP_001124150
MIM 133440
UniProt ID P06730

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4E Products

Required fields are marked with *

My Review for All EIF4E Products

Required fields are marked with *

0
cart-icon