Recombinant Human EIF4E2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EIF4E2-2160H |
| Product Overview : | EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation. In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap.. |
| Molecular Mass : | 28.4 kDa |
| AA Sequence : | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens (human) ] |
| Official Symbol | EIF4E2 |
| Synonyms | EIF4E2; eukaryotic translation initiation factor 4E family member 2; EIF4EL3, eukaryotic translation initiation factor 4E like 3; eukaryotic translation initiation factor 4E type 2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E member 2; eukaryotic translation initiation factor 4E homologous protein; 4E-LP; EIF4EL3; |
| Gene ID | 9470 |
| mRNA Refseq | NM_004846 |
| Protein Refseq | NP_004837 |
| MIM | 605895 |
| UniProt ID | O60573 |
| ◆ Recombinant Proteins | ||
| EIF4E2-4290HF | Recombinant Full Length Human EIF4E2 Protein, GST-tagged | +Inquiry |
| EIF4E2-28495TH | Recombinant Human EIF4E2, T7 -tagged | +Inquiry |
| EIF4E2-01H | Recombinant Human EIF4E2 protein, Myc/DDK-tagged | +Inquiry |
| EIF4E2-12379H | Recombinant Human EIF4E2, GST-tagged | +Inquiry |
| EIF4E2-829H | Recombinant Human EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E2 Products
Required fields are marked with *
My Review for All EIF4E2 Products
Required fields are marked with *
