| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    In Vitro Cell Free System | 
                                
                                
                                    | Tag : | 
                                    GST | 
                                
                                
                                    | Protein Length : | 
                                    431 amino acids | 
                                
                                
                                    | Description : | 
                                    Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]). | 
                                
                                
                                    | Form : | 
                                    50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
                                
                                
                                    | Molecular Mass : | 
                                    73.15 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYI VNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKV LTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF LRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKA EPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI | 
                                
                                
                                    | Applications : | 
                                    Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
                                
                                
                                    | Notes : | 
                                    Best use within three months from the date of receipt of this protein. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |