Recombinant Human EIF5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EIF5-3395H |
Product Overview : | EIF5 MS Standard C13 and N15-labeled recombinant protein (NP_001960) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations. |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EIF5 eukaryotic translation initiation factor 5 [ Homo sapiens (human) ] |
Official Symbol | EIF5 |
Synonyms | EIF5; eukaryotic translation initiation factor 5; eIF-5; EIF-5A; |
Gene ID | 1983 |
mRNA Refseq | NM_001969 |
Protein Refseq | NP_001960 |
MIM | 601710 |
UniProt ID | P55010 |
◆ Recombinant Proteins | ||
EIF5-9994Z | Recombinant Zebrafish EIF5 | +Inquiry |
EIF5-1726R | Recombinant Rat EIF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5-3395H | Recombinant Human EIF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF5-8633H | Recombinant Human EIF5 protein(Met1-Asp150), GST-tagged | +Inquiry |
EIF5-6913HF | Recombinant Full Length Human EIF5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5 Products
Required fields are marked with *
My Review for All EIF5 Products
Required fields are marked with *