Recombinant Full Length Human EPHA2 Protein, C-Flag-tagged
Cat.No. : | EPHA2-698HFL |
Product Overview : | Recombinant Full Length Human EPHA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Mutations in this gene are the cause of certain genetically-related cataract disorders. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 108.1 kDa |
AA Sequence : | MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVC NVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFT KIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAH FPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGF FKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTP PQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGF SVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHR RRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKG MLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGAL DKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEA TYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVS EWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Axon guidance |
Full Length : | Full L. |
Gene Name | EPHA2 EPH receptor A2 [ Homo sapiens (human) ] |
Official Symbol | EPHA2 |
Synonyms | ECK; CTPA; ARCC2; CTPP1; CTRCT6 |
Gene ID | 1969 |
mRNA Refseq | NM_004431.5 |
Protein Refseq | NP_004422.2 |
MIM | 176946 |
UniProt ID | P29317 |
◆ Recombinant Proteins | ||
EPHA2-1698M | Recombinant Mouse EPHA2 protein, His-tagged | +Inquiry |
Epha2-197M | Active Recombinant Mouse Epha2, Fc Chimera | +Inquiry |
EPHA2-27H | Active Recombinant Human EPHA2 Protein (Gln25-Asn534), C-6×His tagged | +Inquiry |
EPHA2-409H | Recombinant Human EPHA2, His tagged | +Inquiry |
EPHA2-8628H | Active Recombinant Human EPHA2 protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA2-2138MCL | Recombinant Mouse EPHA2 cell lysate | +Inquiry |
EPHA2-1072HCL | Recombinant Human EPHA2 cell lysate | +Inquiry |
EPHA2-001HCL | Recombinant Human EPHA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHA2 Products
Required fields are marked with *
My Review for All EPHA2 Products
Required fields are marked with *
0
Inquiry Basket