Recombinant Full Length Human FAM185A Protein, GST-tagged
Cat.No. : | FAM185A-4539HF |
Product Overview : | Human FAM185A full-length ORF ( ABM84285.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | FAM185A (Family With Sequence Similarity 185 Member A) is a Protein Coding gene. |
Molecular Mass : | 42.24 kDa |
AA Sequence : | MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM185A family with sequence similarity 185, member A [ Homo sapiens ] |
Official Symbol | FAM185A |
Synonyms | FAM185A; family with sequence similarity 185, member A; protein FAM185A; MGC35361; |
Gene ID | 222234 |
mRNA Refseq | NM_001145268 |
Protein Refseq | NP_001138740 |
UniProt ID | Q8N0U4 |
◆ Recombinant Proteins | ||
FAM185A-3726H | Recombinant Human FAM185A Protein, GST-tagged | +Inquiry |
FAM185A-4539HF | Recombinant Full Length Human FAM185A Protein, GST-tagged | +Inquiry |
FAM185A-3024M | Recombinant Mouse FAM185A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM185A-3857H | Recombinant Human FAM185A protein, His-tagged | +Inquiry |
FAM185A-5549M | Recombinant Mouse FAM185A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM185A Products
Required fields are marked with *
My Review for All FAM185A Products
Required fields are marked with *
0
Inquiry Basket