Recombinant Full Length Human FAM185A Protein, GST-tagged

Cat.No. : FAM185A-4539HF
Product Overview : Human FAM185A full-length ORF ( ABM84285.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : FAM185A (Family With Sequence Similarity 185 Member A) is a Protein Coding gene.
Molecular Mass : 42.24 kDa
AA Sequence : MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM185A family with sequence similarity 185, member A [ Homo sapiens ]
Official Symbol FAM185A
Synonyms FAM185A; family with sequence similarity 185, member A; protein FAM185A; MGC35361;
Gene ID 222234
mRNA Refseq NM_001145268
Protein Refseq NP_001138740
UniProt ID Q8N0U4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM185A Products

Required fields are marked with *

My Review for All FAM185A Products

Required fields are marked with *

0
cart-icon