Recombinant Human FAM185A protein, His-tagged
Cat.No. : | FAM185A-3857H |
Product Overview : | Recombinant Human FAM185A protein(1-144 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-144 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM185A family with sequence similarity 185, member A [ Homo sapiens ] |
Official Symbol | FAM185A |
Synonyms | FAM185A; family with sequence similarity 185, member A; protein FAM185A; MGC35361; |
Gene ID | 222234 |
mRNA Refseq | NM_001145268 |
Protein Refseq | NP_001138740 |
UniProt ID | Q8N0U4 |
◆ Recombinant Proteins | ||
FAM185A-3024M | Recombinant Mouse FAM185A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM185A-3857H | Recombinant Human FAM185A protein, His-tagged | +Inquiry |
FAM185A-5549M | Recombinant Mouse FAM185A Protein | +Inquiry |
FAM185A-3726H | Recombinant Human FAM185A Protein, GST-tagged | +Inquiry |
FAM185A-4539HF | Recombinant Full Length Human FAM185A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM185A Products
Required fields are marked with *
My Review for All FAM185A Products
Required fields are marked with *
0
Inquiry Basket