Recombinant Full Length Human FAM221A Protein, GST-tagged

Cat.No. : FAM221A-3254HF
Product Overview : Human C7orf46 full-length ORF (NP_954587.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 298 amino acids
Description : FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B.
Molecular Mass : 59.5 kDa
AA Sequence : MERLTLPLGGAAAVDEYLEHRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKRFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM221A family with sequence similarity 221, member A [ Homo sapiens ]
Official Symbol FAM221A
Synonyms C7orf46
Gene ID 340277
mRNA Refseq NM_199136
Protein Refseq NP_954587
UniProt ID A4D161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM221A Products

Required fields are marked with *

My Review for All FAM221A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon