Recombinant Full Length Human FAM229B Protein, GST-tagged
Cat.No. : | FAM229B-2704HF |
Product Overview : | Human FAM229B full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 80 amino acids |
Description : | FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A. |
Molecular Mass : | 35.2 kDa |
AA Sequence : | MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ] |
Official Symbol | FAM229B |
Synonyms | FAM229B; family with sequence similarity 229 member B; Family With Sequence Similarity 229 Member B; C6orf225; Family With Sequence Similarity 229, Member B; Chromosome 6 Open Reading Frame 225; UPF0731 Protein C6orf225; Protein FAM229B |
Gene ID | 619208 |
mRNA Refseq | NM_001033564 |
Protein Refseq | NP_001028736 |
UniProt ID | Q4G0N7 |
◆ Recombinant Proteins | ||
FAM229B-2704HF | Recombinant Full Length Human FAM229B Protein, GST-tagged | +Inquiry |
FAM229B-0121H | Recombinant Human FAM229B Protein, GST-Tagged | +Inquiry |
Fam229b-2934M | Recombinant Mouse Fam229b Protein, Myc/DDK-tagged | +Inquiry |
FAM229B-2066H | Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM229B-364H | Recombinant Human FAM229B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM229B Products
Required fields are marked with *
My Review for All FAM229B Products
Required fields are marked with *
0
Inquiry Basket