Recombinant Human FAM229B Protein, GST-Tagged
| Cat.No. : | FAM229B-0121H |
| Product Overview : | Human FAM229B full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A. |
| Molecular Mass : | 35.2 kDa |
| AA Sequence : | MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ] |
| Official Symbol | FAM229B |
| Synonyms | FAM229B; family with sequence similarity 229 member B; Family With Sequence Similarity 229 Member B; C6orf225; Family With Sequence Similarity 229, Member B; Chromosome 6 Open Reading Frame 225; UPF0731 Protein C6orf225; Protein FAM229B |
| Gene ID | 619208 |
| mRNA Refseq | NM_001033564 |
| Protein Refseq | NP_001028736 |
| UniProt ID | Q4G0N7 |
| ◆ Recombinant Proteins | ||
| Fam229b-2934M | Recombinant Mouse Fam229b Protein, Myc/DDK-tagged | +Inquiry |
| FAM229B-0121H | Recombinant Human FAM229B Protein, GST-Tagged | +Inquiry |
| FAM229B-2704HF | Recombinant Full Length Human FAM229B Protein, GST-tagged | +Inquiry |
| FAM229B-2066H | Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FAM229B-364H | Recombinant Human FAM229B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM229B Products
Required fields are marked with *
My Review for All FAM229B Products
Required fields are marked with *
