Recombinant Human FAM229B Protein, GST-Tagged

• Cat.No.: FAM229B-0121H
• Product Overview: Human FAM229B full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A.
• Molecular Mass: 35.2 kDa
• AA Sequence: MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ]
• Official Symbol: FAM229B
• Synonyms: FAM229B; family with sequence similarity 229 member B; Family With Sequence Similarity 229 Member B; C6orf225; Family With Sequence Similarity 229, Member B; Chromosome 6 Open Reading Frame 225; UPF0731 Protein C6orf225; Protein FAM229B
• Gene ID: 619208
• mRNA Refseq: NM_001033564
• Protein Refseq: NP_001028736
• UniProt ID: Q4G0N7