Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM229B-2066H
Product Overview : C6orf225 MS Standard C13 and N15-labeled recombinant protein (NP_001028736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A.
Molecular Mass : 8.7 kDa
AA Sequence : MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ]
Official Symbol FAM229B
Synonyms FAM229B; family with sequence similarity 229 member B; C6orf225; protein FAM229B; UPF0731 protein C6orf225
Gene ID 619208
mRNA Refseq NM_001033564
Protein Refseq NP_001028736
UniProt ID Q4G0N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM229B Products

Required fields are marked with *

My Review for All FAM229B Products

Required fields are marked with *

0
cart-icon
0
compare icon