Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM229B-2066H |
Product Overview : | C6orf225 MS Standard C13 and N15-labeled recombinant protein (NP_001028736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A. |
Molecular Mass : | 8.7 kDa |
AA Sequence : | MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ] |
Official Symbol | FAM229B |
Synonyms | FAM229B; family with sequence similarity 229 member B; C6orf225; protein FAM229B; UPF0731 protein C6orf225 |
Gene ID | 619208 |
mRNA Refseq | NM_001033564 |
Protein Refseq | NP_001028736 |
UniProt ID | Q4G0N7 |
◆ Recombinant Proteins | ||
FAM229B-2066H | Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fam229b-2934M | Recombinant Mouse Fam229b Protein, Myc/DDK-tagged | +Inquiry |
FAM229B-0121H | Recombinant Human FAM229B Protein, GST-Tagged | +Inquiry |
FAM229B-364H | Recombinant Human FAM229B Protein, MYC/DDK-tagged | +Inquiry |
FAM229B-2704HF | Recombinant Full Length Human FAM229B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM229B Products
Required fields are marked with *
My Review for All FAM229B Products
Required fields are marked with *