Recombinant Full Length Human FAM89B Protein, GST-tagged
| Cat.No. : | FAM89B-4651HF |
| Product Overview : | Human FAM89B full-length ORF ( NP_690045.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 176 amino acids |
| Description : | FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A. |
| Molecular Mass : | 45.1 kDa |
| AA Sequence : | MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM89B family with sequence similarity 89, member B [ Homo sapiens ] |
| Official Symbol | FAM89B |
| Synonyms | FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1; |
| Gene ID | 23625 |
| mRNA Refseq | NM_001098784 |
| Protein Refseq | NP_001092254 |
| MIM | 616128 |
| UniProt ID | Q8N5H3 |
| ◆ Recombinant Proteins | ||
| FAM89B-1636R | Recombinant Rhesus monkey FAM89B Protein, His-tagged | +Inquiry |
| FAM89B-3812H | Recombinant Human FAM89B Protein, GST-tagged | +Inquiry |
| FAM89B-4031H | Recombinant Human FAM89B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FAM89B-1460R | Recombinant Rhesus Macaque FAM89B Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM89B-4651HF | Recombinant Full Length Human FAM89B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM89B-589HCL | Recombinant Human FAM89B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM89B Products
Required fields are marked with *
My Review for All FAM89B Products
Required fields are marked with *
