Recombinant Human FAM89B Protein, GST-tagged
Cat.No. : | FAM89B-3812H |
Product Overview : | Human FAM89B full-length ORF ( NP_690045.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A. |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM89B family with sequence similarity 89, member B [ Homo sapiens ] |
Official Symbol | FAM89B |
Synonyms | FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1; |
Gene ID | 23625 |
mRNA Refseq | NM_001098784 |
Protein Refseq | NP_001092254 |
MIM | 616128 |
UniProt ID | Q8N5H3 |
◆ Recombinant Proteins | ||
FAM89B-4651HF | Recombinant Full Length Human FAM89B Protein, GST-tagged | +Inquiry |
Fam89b-2950M | Recombinant Mouse Fam89b Protein, Myc/DDK-tagged | +Inquiry |
FAM89B-3812H | Recombinant Human FAM89B Protein, GST-tagged | +Inquiry |
FAM89B-1460R | Recombinant Rhesus Macaque FAM89B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM89B-1636R | Recombinant Rhesus monkey FAM89B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM89B-589HCL | Recombinant Human FAM89B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM89B Products
Required fields are marked with *
My Review for All FAM89B Products
Required fields are marked with *
0
Inquiry Basket