Recombinant Full Length Human FAM9C Protein, GST-tagged

Cat.No. : FAM9C-4661HF
Product Overview : Human FAM9C full-length ORF ( NP_777561.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 166 amino acids
Description : This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
Molecular Mass : 45.6 kDa
AA Sequence : MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ]
Official Symbol FAM9C
Synonyms FAM9C; family with sequence similarity 9 member C; Family With Sequence Similarity 9 Member C; Testis Expressed 39C; Family With Sequence Similarity 9, Member C; Protein FAM9C; TEX39C; protein FAM9C; testis expressed 39C
Gene ID 171484
mRNA Refseq NM_174901
Protein Refseq NP_777561
MIM 300479
UniProt ID Q8IZT9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM9C Products

Required fields are marked with *

My Review for All FAM9C Products

Required fields are marked with *

0
cart-icon