Recombinant Full Length Human FAM9C Protein, GST-tagged

• Cat.No.: FAM9C-4661HF
• Product Overview: Human FAM9C full-length ORF ( NP_777561.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 166 amino acids
• Description: This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]
• Molecular Mass: 45.6 kDa
• AA Sequence: MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ]
• Official Symbol: FAM9C
• Synonyms: FAM9C; family with sequence similarity 9 member C; Family With Sequence Similarity 9 Member C; Testis Expressed 39C; Family With Sequence Similarity 9, Member C; Protein FAM9C; TEX39C; protein FAM9C; testis expressed 39C
• Gene ID: 171484
• mRNA Refseq: NM_174901
• Protein Refseq: NP_777561
• MIM: 300479
• UniProt ID: Q8IZT9