Recombinant Human FAM9C Protein, GST-tagged
| Cat.No. : | FAM9C-3823H |
| Product Overview : | Human FAM9C full-length ORF ( NP_777561.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ] |
| Official Symbol | FAM9C |
| Synonyms | FAM9C; family with sequence similarity 9 member C; Family With Sequence Similarity 9 Member C; Testis Expressed 39C; Family With Sequence Similarity 9, Member C; Protein FAM9C; TEX39C; protein FAM9C; testis expressed 39C |
| Gene ID | 171484 |
| mRNA Refseq | NM_174901 |
| Protein Refseq | NP_777561 |
| MIM | 300479 |
| UniProt ID | Q8IZT9 |
| ◆ Recombinant Proteins | ||
| FAM9C-4661HF | Recombinant Full Length Human FAM9C Protein, GST-tagged | +Inquiry |
| FAM9C-3823H | Recombinant Human FAM9C Protein, GST-tagged | +Inquiry |
| FAM9C-416H | Recombinant Human FAM9C | +Inquiry |
| FAM9C-2130H | Recombinant Human FAM9C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FAM9C-2922H | Recombinant Human FAM9C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM9C-6334HCL | Recombinant Human FAM9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM9C Products
Required fields are marked with *
My Review for All FAM9C Products
Required fields are marked with *
