Recombinant Human FAM9C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM9C-2130H
Product Overview : FAM9C MS Standard C13 and N15-labeled recombinant protein (NP_777561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein.
Molecular Mass : 19.2 kDa
AA Sequence : MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ]
Official Symbol FAM9C
Synonyms FAM9C; family with sequence similarity 9 member C; TEX39C; protein FAM9C; testis expressed 39C
Gene ID 171484
mRNA Refseq NM_174901
Protein Refseq NP_777561
MIM 300479
UniProt ID Q8IZT9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM9C Products

Required fields are marked with *

My Review for All FAM9C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon