Recombinant Human FAM9C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM9C-2130H |
Product Overview : | FAM9C MS Standard C13 and N15-labeled recombinant protein (NP_777561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ] |
Official Symbol | FAM9C |
Synonyms | FAM9C; family with sequence similarity 9 member C; TEX39C; protein FAM9C; testis expressed 39C |
Gene ID | 171484 |
mRNA Refseq | NM_174901 |
Protein Refseq | NP_777561 |
MIM | 300479 |
UniProt ID | Q8IZT9 |
◆ Recombinant Proteins | ||
FAM9C-4661HF | Recombinant Full Length Human FAM9C Protein, GST-tagged | +Inquiry |
FAM9C-3823H | Recombinant Human FAM9C Protein, GST-tagged | +Inquiry |
FAM9C-2130H | Recombinant Human FAM9C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM9C-416H | Recombinant Human FAM9C | +Inquiry |
FAM9C-2922H | Recombinant Human FAM9C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM9C-6334HCL | Recombinant Human FAM9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM9C Products
Required fields are marked with *
My Review for All FAM9C Products
Required fields are marked with *
0
Inquiry Basket