Recombinant Full Length Human FBXO2 Protein, GST-tagged
Cat.No. : | FBXO2-5024HF |
Product Overview : | Human FBXO2 full-length ORF ( AAH25233, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 296 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 58.3 kDa |
AA Sequence : | MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO2 F-box protein 2 [ Homo sapiens ] |
Official Symbol | FBXO2 |
Synonyms | FBXO2; F-box protein 2; F box only protein 2 , OCP1, organ of Corti protein 1; F-box only protein 2; Fbg1; Fbs1; FBX2; Nfb42; F-box gene 1; organ of Corti protein 1; FBG1; OCP1; NFB42; |
Gene ID | 26232 |
mRNA Refseq | NM_012168 |
Protein Refseq | NP_036300 |
MIM | 607112 |
UniProt ID | Q9UK22 |
◆ Recombinant Proteins | ||
FBXO2-5024HF | Recombinant Full Length Human FBXO2 Protein, GST-tagged | +Inquiry |
FBXO2-896H | Recombinant Human FBXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO2-259H | Recombinant Human FBXO2, His-tagged | +Inquiry |
Fbxo2-2964M | Recombinant Mouse Fbxo2 Protein, Myc/DDK-tagged | +Inquiry |
FBXO2-3919H | Recombinant Human FBXO2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO2-6306HCL | Recombinant Human FBXO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO2 Products
Required fields are marked with *
My Review for All FBXO2 Products
Required fields are marked with *