Recombinant Full Length Human FBXO2 Protein, C-Flag-tagged
Cat.No. : | FBXO2-975HFL |
Product Overview : | Recombinant Full Length Human FBXO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQA CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVE HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGR SDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWK GWFGARVTNSSVWVEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | FBXO2 F-box protein 2 [ Homo sapiens (human) ] |
Official Symbol | FBXO2 |
Synonyms | FBG1; FBX2; Fbs1; OCP1; NFB42 |
Gene ID | 26232 |
mRNA Refseq | NM_012168.6 |
Protein Refseq | NP_036300.2 |
MIM | 607112 |
UniProt ID | Q9UK22 |
◆ Recombinant Proteins | ||
Fbxo2-2964M | Recombinant Mouse Fbxo2 Protein, Myc/DDK-tagged | +Inquiry |
FBXO2-975HFL | Recombinant Full Length Human FBXO2 Protein, C-Flag-tagged | +Inquiry |
FBXO2-12788H | Recombinant Human FBXO2, GST-tagged | +Inquiry |
FBXO2-259H | Recombinant Human FBXO2, His-tagged | +Inquiry |
FBXO2-1470H | Recombinant Human FBXO2 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO2-6306HCL | Recombinant Human FBXO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO2 Products
Required fields are marked with *
My Review for All FBXO2 Products
Required fields are marked with *
0
Inquiry Basket