Recombinant Full Length Human Fms-Related Tyrosine Kinase 3 Ligand(Flt3Lg) Protein, His-Tagged
| Cat.No. : | RFL7140HF |
| Product Overview : | Recombinant Full Length Human Fms-related tyrosine kinase 3 ligand(FLT3LG) Protein (P49771) (27-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (27-235) |
| Form : | Lyophilized powder |
| AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FLT3LG |
| Synonyms | FL; Flt 3 ligand; Flt 3L; Flt3 L; FLT3 LG; Flt3 ligand; Flt3L; FLT3L_HUMAN; Flt3lg; Fms related tyrosine kinase 3 ligand; Fms-related tyrosine kinase 3 ligand; SL cytokine |
| UniProt ID | P49771 |
| ◆ Recombinant Proteins | ||
| FLT3LG-25H | Active Recombinant Human FLT3L protein | +Inquiry |
| Flt3lg-1357M | Recombinant Mouse Flt3lg protein, His-tagged | +Inquiry |
| FLT3LG-151H | Active Recombinant Human FLT3LG | +Inquiry |
| FLT3LG-154H | Active Recombinant Human FLT3LG | +Inquiry |
| FLT3LG-100P | Recombinant Active Pig FLT3LG Protein, His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
