Recombinant Full Length Human FOSL1 Protein, C-Flag-tagged
Cat.No. : | FOSL1-2065HFL |
Product Overview : | Recombinant Full Length Human FOSL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | FOSL1 FOS like 1, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
Official Symbol | FOSL1 |
Synonyms | FRA; FRA1; fra-1 |
Gene ID | 8061 |
mRNA Refseq | NM_005438.5 |
Protein Refseq | NP_005429.1 |
MIM | 136515 |
UniProt ID | P15407 |
◆ Recombinant Proteins | ||
FOSL1-8500H | Active Recombinant Human FOSL1, His-tagged | +Inquiry |
FOSL1-001H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged | +Inquiry |
Fosl1-7853M | Recombinant Mouse Fosl1 protein, His-tagged | +Inquiry |
FOSL1-12965H | Recombinant Human FOSL1, GST-tagged | +Inquiry |
FOSL1-5042HF | Recombinant Full Length Human FOSL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *
0
Inquiry Basket