Recombinant Full Length Human FRAT2 Protein, GST-tagged
Cat.No. : | FRAT2-5144HF |
Product Overview : | Human FRAT2 full-length ORF ( AAH20165.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 233 amino acids |
Description : | The protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. [provided by RefSeq |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FRAT2 frequently rearranged in advanced T-cell lymphomas 2 [ Homo sapiens ] |
Official Symbol | FRAT2 |
Synonyms | FRAT2; frequently rearranged in advanced T-cell lymphomas 2; GSK-3-binding protein FRAT2; GSK 3 binding protein FRAT2; FRAT-2; GSK-3 binding protein FRAT2; MGC10562; |
Gene ID | 23401 |
mRNA Refseq | NM_012083 |
Protein Refseq | NP_036215 |
MIM | 605006 |
UniProt ID | O75474 |
◆ Recombinant Proteins | ||
FRAT2-4491H | Recombinant Human FRAT2 Protein, GST-tagged | +Inquiry |
FRAT2-3354M | Recombinant Mouse FRAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRAT2-6031M | Recombinant Mouse FRAT2 Protein | +Inquiry |
FRAT2-5144HF | Recombinant Full Length Human FRAT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRAT2-666HCL | Recombinant Human FRAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRAT2 Products
Required fields are marked with *
My Review for All FRAT2 Products
Required fields are marked with *
0
Inquiry Basket