Recombinant Human FRAT2 Protein, GST-tagged

Cat.No. : FRAT2-4491H
Product Overview : Human FRAT2 full-length ORF ( AAH20165.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. [provided by RefSeq
Molecular Mass : 50.5 kDa
AA Sequence : MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FRAT2 frequently rearranged in advanced T-cell lymphomas 2 [ Homo sapiens ]
Official Symbol FRAT2
Synonyms FRAT2; frequently rearranged in advanced T-cell lymphomas 2; GSK-3-binding protein FRAT2; GSK 3 binding protein FRAT2; FRAT-2; GSK-3 binding protein FRAT2; MGC10562;
Gene ID 23401
mRNA Refseq NM_012083
Protein Refseq NP_036215
MIM 605006
UniProt ID O75474

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FRAT2 Products

Required fields are marked with *

My Review for All FRAT2 Products

Required fields are marked with *

0
cart-icon