Recombinant Human FRAT2 Protein, GST-tagged

• Cat.No.: FRAT2-4491H
• Product Overview: Human FRAT2 full-length ORF ( AAH20165.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this intronless gene belongs to the GSK-3-binding protein family. Studies show that this protein plays a role as a positive regulator of the WNT signaling pathway. It may be upregulated in tumor progression. [provided by RefSeq
• Molecular Mass: 50.5 kDa
• AA Sequence: MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FRAT2 frequently rearranged in advanced T-cell lymphomas 2 [ Homo sapiens ]
• Official Symbol: FRAT2
• Synonyms: FRAT2; frequently rearranged in advanced T-cell lymphomas 2; GSK-3-binding protein FRAT2; GSK 3 binding protein FRAT2; FRAT-2; GSK-3 binding protein FRAT2; MGC10562
• Gene ID: 23401
• mRNA Refseq: NM_012083
• Protein Refseq: NP_036215
• MIM: 605006
• UniProt ID: O75474