Recombinant Full Length Human FST Protein, GST-tagged
Cat.No. : | FST-5092HF |
Product Overview : | Human FST full-length ORF ( AAH04107, 1 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 344 amino acids |
Description : | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. [provided by RefSeq |
Molecular Mass : | 63.58 kDa |
AA Sequence : | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FST follistatin [ Homo sapiens ] |
Official Symbol | FST |
Synonyms | FST; follistatin; FS; activin-binding protein; follistatin isoform FST317; |
Gene ID | 10468 |
mRNA Refseq | NM_006350 |
Protein Refseq | NP_006341 |
MIM | 136470 |
UniProt ID | P19883 |
◆ Recombinant Proteins | ||
FST-2054R | Recombinant Rat FST Protein, His (Fc)-Avi-tagged | +Inquiry |
FST-2333M | Recombinant Mouse FST protein(Met1-Asn317), hFc-tagged | +Inquiry |
FST-27459TH | Recombinant Human FST, His-tagged | +Inquiry |
FST-570H | Recombinant Human FST Protein, His-tagged | +Inquiry |
FST-102M | Recombinant Mouse FST Protein | +Inquiry |
◆ Native Proteins | ||
FST-001H | Recombinant Human FST Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FST-1771MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-001MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FST Products
Required fields are marked with *
My Review for All FST Products
Required fields are marked with *