Recombinant Full Length Human FSTL3 Protein, C-Flag-tagged
| Cat.No. : | FSTL3-753HFL |
| Product Overview : | Recombinant Full Length Human FSTL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTA WSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGA TYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQEL CGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | FSTL3 follistatin like 3 [ Homo sapiens (human) ] |
| Official Symbol | FSTL3 |
| Synonyms | FLRG; FSRP |
| Gene ID | 10272 |
| mRNA Refseq | NM_005860.3 |
| Protein Refseq | NP_005851.1 |
| MIM | 605343 |
| UniProt ID | O95633 |
| ◆ Recombinant Proteins | ||
| FSTL3-558H | Recombinant Human FSTL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FSTL3-940H | Recombinant Human FSTL3 Protein, His&Avi tagged | +Inquiry |
| FSTL3-3238Z | Recombinant Zebrafish FSTL3 | +Inquiry |
| FSTL3-753HFL | Recombinant Full Length Human FSTL3 Protein, C-Flag-tagged | +Inquiry |
| FSTL3-2981H | Recombinant Human FSTL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL3 Products
Required fields are marked with *
My Review for All FSTL3 Products
Required fields are marked with *
