Recombinant Full Length Human FTO Protein, C-Flag-tagged
Cat.No. : | FTO-330HFL |
Product Overview : | Recombinant Full Length Human FTO Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFL TLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFL KLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFMDPQ KMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDI ETPGLAIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVD NDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLT DIVSELRGQLLEAKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | FTO FTO alpha-ketoglutarate dependent dioxygenase [ Homo sapiens (human) ] |
Official Symbol | FTO |
Synonyms | GDFD; ALKBH9; BMIQ14 |
Gene ID | 79068 |
mRNA Refseq | NM_001080432.3 |
Protein Refseq | NP_001073901.1 |
MIM | 610966 |
UniProt ID | Q9C0B1 |
◆ Recombinant Proteins | ||
Fto-2127M | Recombinant Mouse Fat Mass And Obesity Associated, His-tagged | +Inquiry |
FTO-944H | Recombinant Human FTO Protein, His (Fc)-Avi-tagged | +Inquiry |
FTO-3382M | Recombinant Mouse FTO Protein, His (Fc)-Avi-tagged | +Inquiry |
FTO-1054H | Recombinant Human FTO Protein (T32-P505), Tag Free | +Inquiry |
FTO-14H | Recombinant Human FTO Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FTO-05HFL | Active Recombinant Full Length Human FTO Protein, FLAG tagged | +Inquiry |
FTO-025H | Active Recombinant Human FTO Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FTO Products
Required fields are marked with *
My Review for All FTO Products
Required fields are marked with *
0
Inquiry Basket